Lineage for d2wnra1 (2wnr A:9-187)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2176343Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 2176344Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) (S)
  5. 2177072Family d.14.1.0: automated matches [191504] (1 protein)
    not a true family
  6. 2177073Protein automated matches [190826] (17 species)
    not a true protein
  7. 2177148Species Methanothermobacter thermautotrophicus [TaxId:145262] [225885] (1 PDB entry)
  8. 2177149Domain d2wnra1: 2wnr A:9-187 [231462]
    Other proteins in same PDB: d2wnra2, d2wnrb2, d2wnrc2, d2wnrd2, d2wnre2, d2wnrf2
    automated match to d2je6a1
    complexed with po4

Details for d2wnra1

PDB Entry: 2wnr (more details), 2.65 Å

PDB Description: The structure of Methanothermobacter thermautotrophicus exosome core assembly
PDB Compounds: (A:) probable exosome complex exonuclease 2

SCOPe Domain Sequences for d2wnra1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wnra1 d.14.1.0 (A:9-187) automated matches {Methanothermobacter thermautotrophicus [TaxId: 145262]}
peitrksitdlinnkeridgrslhefrdisietgviskaegssrvklgntqiivgvkpqi
gepfpdtpemgviltnsellpmasptfepgppdersvelsrvvdrciresrmidleklci
iegskvwmlfldlhiidydgnlfdaavlatvaalldtripaaevedgevvinrekmqpl

SCOPe Domain Coordinates for d2wnra1:

Click to download the PDB-style file with coordinates for d2wnra1.
(The format of our PDB-style files is described here.)

Timeline for d2wnra1: