Lineage for d2wmfa1 (2wmf A:35-425)
- Root: SCOPe 2.06
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
3 layers: a/b/a, parallel or mixed beta-sheets of variable sizesSuperfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) 
division into families based on beta-sheet topologies
Family c.37.1.12: ABC transporter ATPase domain-like [52686] (25 proteins)
there are two additional subdomains inserted into the central core that has a RecA-like topologyProtein P-glycoprotein (P-gp) multidrug resistance protein, head domain [310790] (2 species)
Pfam PF09818Species Streptococcus pneumoniae TIGR4 [TaxId:170187] [311048] (1 PDB entry) 
Domain d2wmfa1: 2wmf A:35-425 [304585]
Other proteins in same PDB: d2wmfa2
Details for d2wmfa1
PDB Entry: 2wmf (more details), 1.5 Å
PDB Description: crystal structure of the catalytic module of a family 98 glycoside hydrolase from streptococcus pneumoniae tigr4 (sp4gh98) in its native form.
PDB Compounds: (A:) fucolectin-related proteinSCOPe Domain Sequences for d2wmfa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2wmfa1 c.37.1.12 (A:35-425) P-glycoprotein (P-gp) multidrug resistance protein, head domain {Streptococcus pneumoniae TIGR4 [TaxId: 170187]}
vqmrttinnesplllsplygndngnglwwgntlkgaweaipedvkpyaaielhpakvckp
tsciprdtkelrewyvkmleeaqslnipvflvimsagerntvppewldeqfqkysvlkgv
lnienywiynnqlaphsakylevcakygahfiwhdhekwfwetimndptffeasqkyhkn
lvlatkntpirddagtdsivsgfwlsglcdnwgsstdtwkwwekhytntfetgrardmrs
yasepesmiamemmnvytgggtvynfecaaytfmtndvptpaftkgiipffrhaiqnpap
skeevvnrtkavfwngegrisslngfyqglysndetmplynngryhilpvihekidkeki
ssifpnakiltknseelsskvnylnslypkl
SCOPe Domain Coordinates for d2wmfa1:
Click to download the PDB-style file with coordinates for d2wmfa1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2wmfa1:
- d2wmfa1 is new in SCOPe 2.06-stable
- d2wmfa1 appears in SCOPe 2.07
- d2wmfa1 appears in the current release, SCOPe 2.08
View in 3D
