Lineage for d2wmfa1 (2wmf A:35-425)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2123292Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2123293Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2127048Family c.37.1.12: ABC transporter ATPase domain-like [52686] (25 proteins)
    there are two additional subdomains inserted into the central core that has a RecA-like topology
  6. 2127249Protein P-glycoprotein (P-gp) multidrug resistance protein, head domain [310790] (2 species)
    Pfam PF09818
  7. 2127253Species Streptococcus pneumoniae TIGR4 [TaxId:170187] [311048] (1 PDB entry)
  8. 2127254Domain d2wmfa1: 2wmf A:35-425 [304585]
    Other proteins in same PDB: d2wmfa2

Details for d2wmfa1

PDB Entry: 2wmf (more details), 1.5 Å

PDB Description: crystal structure of the catalytic module of a family 98 glycoside hydrolase from streptococcus pneumoniae tigr4 (sp4gh98) in its native form.
PDB Compounds: (A:) fucolectin-related protein

SCOPe Domain Sequences for d2wmfa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wmfa1 c.37.1.12 (A:35-425) P-glycoprotein (P-gp) multidrug resistance protein, head domain {Streptococcus pneumoniae TIGR4 [TaxId: 170187]}
vqmrttinnesplllsplygndngnglwwgntlkgaweaipedvkpyaaielhpakvckp
tsciprdtkelrewyvkmleeaqslnipvflvimsagerntvppewldeqfqkysvlkgv
lnienywiynnqlaphsakylevcakygahfiwhdhekwfwetimndptffeasqkyhkn
lvlatkntpirddagtdsivsgfwlsglcdnwgsstdtwkwwekhytntfetgrardmrs
yasepesmiamemmnvytgggtvynfecaaytfmtndvptpaftkgiipffrhaiqnpap
skeevvnrtkavfwngegrisslngfyqglysndetmplynngryhilpvihekidkeki
ssifpnakiltknseelsskvnylnslypkl

SCOPe Domain Coordinates for d2wmfa1:

Click to download the PDB-style file with coordinates for d2wmfa1.
(The format of our PDB-style files is described here.)

Timeline for d2wmfa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2wmfa2