Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies) 2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies |
Superfamily c.10.2: L domain-like [52058] (9 families) less regular structure consisting of variable repeats |
Family c.10.2.0: automated matches [191489] (1 protein) not a true family |
Protein automated matches [190787] (10 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188042] (11 PDB entries) |
Domain d2wfha_: 2wfh A: [169305] automated match to d1w8aa_ complexed with so4 |
PDB Entry: 2wfh (more details), 1.8 Å
SCOPe Domain Sequences for d2wfha_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2wfha_ c.10.2.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} cptectcldtvvrcsnkglkvlpkgiprdvtelyldgnqftlvpkelsnykhltlidlsn nristlsnqsfsnmtqlltlilsynrlrcipprtfdglkslrllslhgndisvvpegafn dlsalshlaiganplycdcnmqwlsdwvkseykepgiarcagpgemadklllttpskkft c
Timeline for d2wfha_: