Lineage for d2wfha_ (2wfh A:)
- Root: SCOPe 2.05
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies)
2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies
Superfamily c.10.2: L domain-like [52058] (9 families) 
less regular structure consisting of variable repeats
Family c.10.2.0: automated matches [191489] (1 protein)
not a true familyProtein automated matches [190787] (10 species)
not a true protein
Species Human (Homo sapiens) [TaxId:9606] [188042] (11 PDB entries) 
Domain d2wfha_: 2wfh A: [169305]
automated match to d1w8aa_
complexed with so4
Details for d2wfha_
PDB Entry: 2wfh (more details), 1.8 Å
PDB Description: the human slit 2 dimerization domain d4
PDB Compounds: (A:) slit homolog 2 protein c-productSCOPe Domain Sequences for d2wfha_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2wfha_ c.10.2.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
cptectcldtvvrcsnkglkvlpkgiprdvtelyldgnqftlvpkelsnykhltlidlsn
nristlsnqsfsnmtqlltlilsynrlrcipprtfdglkslrllslhgndisvvpegafn
dlsalshlaiganplycdcnmqwlsdwvkseykepgiarcagpgemadklllttpskkft
c
SCOPe Domain Coordinates for d2wfha_:
Click to download the PDB-style file with coordinates for d2wfha_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2wfha_:
- d2wfha_ first appeared in SCOPe 2.01
- d2wfha_ appears in SCOPe 2.04
- d2wfha_ appears in SCOPe 2.06
- d2wfha_ appears in the current release, SCOPe 2.08
View in 3D
