Lineage for d2w2ne_ (2w2n E:)

  1. Root: SCOPe 2.05
  2. 1959977Class g: Small proteins [56992] (92 folds)
  3. 1960255Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 1961206Superfamily g.3.11: EGF/Laminin [57196] (8 families) (S)
  5. 1961820Family g.3.11.0: automated matches [227227] (1 protein)
    not a true family
  6. 1961821Protein automated matches [226968] (3 species)
    not a true protein
  7. 1961822Species Human (Homo sapiens) [TaxId:9606] [225423] (24 PDB entries)
  8. 1961835Domain d2w2ne_: 2w2n E: [244016]
    Other proteins in same PDB: d2w2na_
    automated match to d3bpse1
    complexed with ca; mutant

Details for d2w2ne_

PDB Entry: 2w2n (more details), 2.3 Å

PDB Description: wt pcsk9-deltac bound to egf-a h306y mutant of ldlr
PDB Compounds: (E:) low-density lipoprotein receptor

SCOPe Domain Sequences for d2w2ne_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2w2ne_ g.3.11.0 (E:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nlyfqgamgtnecldnnggcsyvcndlkigyeclcpdgfqlvaqrrced

SCOPe Domain Coordinates for d2w2ne_:

Click to download the PDB-style file with coordinates for d2w2ne_.
(The format of our PDB-style files is described here.)

Timeline for d2w2ne_: