Lineage for d2w0ld_ (2w0l D:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1755448Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1757949Protein automated matches [190119] (18 species)
    not a true protein
  7. 1758005Species Human (Homo sapiens) [TaxId:9606] [188740] (120 PDB entries)
  8. 1758108Domain d2w0ld_: 2w0l D: [168984]
    automated match to d1cd0a_
    mutant

Details for d2w0ld_

PDB Entry: 2w0l (more details), 2.2 Å

PDB Description: crystal structure of the mutant h8p from the recombinant variable domain 6jal2
PDB Compounds: (D:) v1-22 protein

SCOPe Domain Sequences for d2w0ld_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2w0ld_ b.1.1.1 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nfmltqppsvsespgktvtisctrssgsiasnyvqwyqqrpgsspttviyednqrpsgvp
drfsgsidsssnsasltisglktedeadyycqsydssnhvvfgggtkltvl

SCOPe Domain Coordinates for d2w0ld_:

Click to download the PDB-style file with coordinates for d2w0ld_.
(The format of our PDB-style files is described here.)

Timeline for d2w0ld_: