Lineage for d2w0ka_ (2w0k A:)
- Root: SCOPe 2.04
Class b: All beta proteins [48724] (176 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families) 
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) Protein automated matches [190119] (19 species)
not a true protein
Species Human (Homo sapiens) [TaxId:9606] [188740] (96 PDB entries) 
Domain d2w0ka_: 2w0k A: [168982]
automated match to d1cd0a_
Details for d2w0ka_
PDB Entry: 2w0k (more details), 2.35 Å
PDB Description: crystal structure of the recombinant variable domain 6jal2
PDB Compounds: (A:) v1-22 proteinSCOPe Domain Sequences for d2w0ka_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2w0ka_ b.1.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nfmltqphsvsespgktvtisctrssgsiasnyvqwyqqrpgsspttviyednqrpsgvp
drfsgsidsssnsasltisglktedeadyycqsydssnhvvfgggtkltvl
SCOPe Domain Coordinates for d2w0ka_:
Click to download the PDB-style file with coordinates for d2w0ka_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2w0ka_:
- d2w0ka_ first appeared in SCOPe 2.01
- d2w0ka_ appears in SCOPe 2.03
- d2w0ka_ appears in SCOPe 2.05
- d2w0ka_ appears in the current release, SCOPe 2.08, called d2w0ka1
View in 3D
