Class b: All beta proteins [48724] (177 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein automated matches [190119] (22 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188740] (183 PDB entries) |
Domain d2vyrf_: 2vyr F: [231363] Other proteins in same PDB: d2vyra_, d2vyrb_, d2vyrc_, d2vyrd_ automated match to d1ieha_ complexed with so4 |
PDB Entry: 2vyr (more details), 2 Å
SCOPe Domain Sequences for d2vyrf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vyrf_ b.1.1.1 (F:) automated matches {Human (Homo sapiens) [TaxId: 9606]} evqllesggglvqpggslrlscaasgftfeeyamlwvrqapgkglewvsginargyttyy adsvkgrftisrdnskntlylqmnslrtedtavyycakpwypfmaskgsefdywgqgtlv tvss
Timeline for d2vyrf_: