Lineage for d2vwra_ (2vwr A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2056344Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 2056345Superfamily b.36.1: PDZ domain-like [50156] (7 families) (S)
    peptide-binding domain
  5. 2056880Family b.36.1.0: automated matches [191362] (1 protein)
    not a true family
  6. 2056881Protein automated matches [190436] (8 species)
    not a true protein
  7. 2056895Species Human (Homo sapiens) [TaxId:9606] [187333] (97 PDB entries)
  8. 2056905Domain d2vwra_: 2vwr A: [168885]
    automated match to d1iu0a_

Details for d2vwra_

PDB Entry: 2vwr (more details), 1.3 Å

PDB Description: crystal structure of the second pdz domain of numb-binding protein 2
PDB Compounds: (A:) ligand of numb protein x 2

SCOPe Domain Sequences for d2vwra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vwra_ b.36.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
smeilqvalhkrdsgeqlgiklvrrtdepgvfildllegglaaqdgrlssndrvlaingh
dlkygtpelaaqiiqasgervnltiarpgkpeiel

SCOPe Domain Coordinates for d2vwra_:

Click to download the PDB-style file with coordinates for d2vwra_.
(The format of our PDB-style files is described here.)

Timeline for d2vwra_: