Lineage for d2vwja1 (2vwj A:1-347)
- Root: SCOPe 2.05
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the restSuperfamily c.55.3: Ribonuclease H-like [53098] (15 families) 
consists of one domain of this fold
Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (16 proteins)
contains Pfam PF00929
Protein automated matches [190162] (5 species)
not a true protein
Species Thermococcus gorgonarius [TaxId:71997] [225933] (3 PDB entries) 
Domain d2vwja1: 2vwj A:1-347 [153675]
Other proteins in same PDB: d2vwja2
automated match to d1tgoa1
complexed with k
Details for d2vwja1
PDB Entry: 2vwj (more details), 2.78 Å
PDB Description: uracil recognition in archaeal dna polymerases captured by x-ray crystallography.
PDB Compounds: (A:) DNA polymeraseSCOPe Domain Sequences for d2vwja1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vwja1 c.55.3.5 (A:1-347) automated matches {Thermococcus gorgonarius [TaxId: 71997]}
mildtdyitedgkpvirifkkengefkidydrnfepyiyallkddsaiedvkkitaerhg
ttvrvvraekvkkkflgrpievwklyfthpqdvpairdkikehpavvdiyeydipfakry
lidkglipmegdeelkmlafdietlyhegekfaegpilmisyadeegarvitwrnidlpy
vdvvstekemikrflkvvkekdpdvlityngdnfafaylkkrseklgvkfilgregsepk
iqrmgdrfavevkgrihfdlypvirrtinlptytleavyeaifgqpkekvyaeeiaqawe
tgeglervarysmedakvtyelgkeffpmeaqlsrlvgqslwdvsrs
SCOPe Domain Coordinates for d2vwja1:
Click to download the PDB-style file with coordinates for d2vwja1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2vwja1:
- d2vwja1 first appeared in SCOP 1.75
- d2vwja1 appears in SCOPe 2.04
- d2vwja1 appears in SCOPe 2.06
- d2vwja1 appears in the current release, SCOPe 2.08
View in 3D
