Lineage for d2vrea_ (2vre A:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1584360Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 1584361Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 1585212Family c.14.1.0: automated matches [191346] (1 protein)
    not a true family
  6. 1585213Protein automated matches [190246] (46 species)
    not a true protein
  7. 1585327Species Human (Homo sapiens) [TaxId:9606] [226449] (5 PDB entries)
  8. 1585328Domain d2vrea_: 2vre A: [206422]
    automated match to d3g64c_
    complexed with cl

Details for d2vrea_

PDB Entry: 2vre (more details), 1.95 Å

PDB Description: crystal structure of human peroxisomal delta3,5,delta2,4-dienoyl coa isomerase
PDB Compounds: (A:) delta(3,5)-delta(2,4)-dienoyl-coa isomerase

SCOPe Domain Sequences for d2vrea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vrea_ c.14.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lyfqsmapdhsyeslrvtsaqkhvlhvqlnrpnkrnamnkvfwremvecfnkisrdadcr
avvisgagkmftagidlmdmasdilqpkgddvariswylrdiitryqetfnviercpkpv
iaavhggcigggvdlvtacdirycaqdaffqvkevdvglaadvgtlqrlpkvignqslvn
elaftarkmmadealgsglvsrvfpdkevmldaalalaaeisskspvavqstkvnllysr
dhsvaeslnyvaswnmsmlqtqdlvksvqatt

SCOPe Domain Coordinates for d2vrea_:

Click to download the PDB-style file with coordinates for d2vrea_.
(The format of our PDB-style files is described here.)

Timeline for d2vrea_: