Lineage for d2volb_ (2vol B:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1118105Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 1118106Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 1119627Family b.29.1.22: SPRY domain [141154] (6 proteins)
    Pfam PF00622
  6. 1119649Protein automated matches [190921] (1 species)
    not a true protein
  7. 1119650Species Mouse (Mus musculus) [TaxId:10090] [188414] (3 PDB entries)
  8. 1119654Domain d2volb_: 2vol B: [168752]
    automated match to d2iwgb1
    protein/DNA complex; protein/RNA complex; complexed with fuc

Details for d2volb_

PDB Entry: 2vol (more details), 1.95 Å

PDB Description: Murine TRIM21 in Complex with Murine IgG Fc
PDB Compounds: (B:) 52 kda ro protein

SCOPe Domain Sequences for d2volb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2volb_ b.29.1.22 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
hmvhitldrntanswliiskdrrqvrmgdthqnvsdnkerfsnypmvlgaqrfssgkmyw
evdvtqkeawdlgvcrdsvqrkgqfslspengfwtiwlwqksyeagtspqttlhiqvppc
qigifvdyeagvvsfynitdhgsliytfsecvfagplrpffnvgfnysggnaaplklcpl

SCOPe Domain Coordinates for d2volb_:

Click to download the PDB-style file with coordinates for d2volb_.
(The format of our PDB-style files is described here.)

Timeline for d2volb_: