Lineage for d2voka_ (2vok A:)
- Root: SCOPe 2.05
Class b: All beta proteins [48724] (176 folds) 
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
sandwich; 12-14 strands in 2 sheets; complex topologySuperfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) 
Family b.29.1.22: SPRY domain [141154] (6 proteins)
Pfam PF00622Protein automated matches [190921] (2 species)
not a true proteinSpecies Mouse (Mus musculus) [TaxId:10090] [188414] (2 PDB entries) 
Domain d2voka_: 2vok A: [168750]
automated match to d2iwgb1
Details for d2voka_
PDB Entry: 2vok (more details), 1.3 Å
PDB Description: murine trim21
PDB Compounds: (A:) 52 kda ro proteinSCOPe Domain Sequences for d2voka_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2voka_ b.29.1.22 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
ahhhhhhmvhitldrntanswliiskdrrqvrmgdthqnvsdnkerfsnypmvlgaqrfs
sgkmywevdvtqkeawdlgvcrdsvqrkgqfslspengfwtiwlwqdsyeagtspqttlh
iqvppcqigifvdyeagvvsfynitdhgsliytfsecvfagplrpffnvgfnysggnaap
lklcpl
SCOPe Domain Coordinates for d2voka_:
Click to download the PDB-style file with coordinates for d2voka_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2voka_:
- d2voka_ first appeared in SCOPe 2.01
- d2voka_ appears in SCOPe 2.04
- d2voka_ is called d2voka1 in SCOPe 2.06
- d2voka_ appears in the current release, SCOPe 2.08, called d2voka1
View in 3D
