Lineage for d2vkaa_ (2vka A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2005118Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 2005119Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families) (S)
  5. 2005953Family a.93.1.0: automated matches [191605] (1 protein)
    not a true family
  6. 2005954Protein automated matches [191104] (11 species)
    not a true protein
  7. 2006037Species Pleurotus eryngii [TaxId:5323] [226503] (19 PDB entries)
  8. 2006049Domain d2vkaa_: 2vka A: [231341]
    automated match to d4fcna_
    complexed with ca, gol, hem, so4

Details for d2vkaa_

PDB Entry: 2vka (more details), 2 Å

PDB Description: site-directed mutagenesis of the catalytic tryptophan environment in pleurotus eryngii versatile peroxidase
PDB Compounds: (A:) versatile peroxidase vpl2

SCOPe Domain Sequences for d2vkaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vkaa_ a.93.1.0 (A:) automated matches {Pleurotus eryngii [TaxId: 5323]}
atcddgrttanaaccilfpilddiqenlfdgaqcgeevheslrltfhdaigfsptlgggg
adgsiiafdtietnfpanagideivsaqkpfvakhnisagdfiqfagavgvsncpggvri
pfflgrpdavaaspdhlvpepfdsvdsilarmgdagfspvevvwllashsiaaadkvdps
ipgtpfdstpgvfdsqffietqlkgrlfpgtadnkgeaqsplqgeirlqsdhllardpqt
acewqsfvnnqpkiqnrfaatmskmallgqdktklidcsdviptppalvgaahlpagfsl
sdveqacaatpfpalta

SCOPe Domain Coordinates for d2vkaa_:

Click to download the PDB-style file with coordinates for d2vkaa_.
(The format of our PDB-style files is described here.)

Timeline for d2vkaa_: