Lineage for d2vgnb3 (2vgn B:278-381)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1914038Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 1914576Superfamily d.79.3: L30e-like [55315] (4 families) (S)
  5. 1914685Family d.79.3.2: ERF1/Dom34 C-terminal domain-like [55323] (3 proteins)
    automatically mapped to Pfam PF03465
  6. 1914694Protein Dom34 [160509] (1 species)
  7. 1914695Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [160510] (2 PDB entries)
    Uniprot P33309 278-381
  8. 1914697Domain d2vgnb3: 2vgn B:278-381 [153045]
    Other proteins in same PDB: d2vgna1, d2vgna2, d2vgnb1, d2vgnb2
    automated match to d2vgma3
    complexed with gol, po4

Details for d2vgnb3

PDB Entry: 2vgn (more details), 2.5 Å

PDB Description: structure of s. cerevisiae dom34, a translation termination-like factor involved in rna quality control pathways and interacting with hbs1 (selenomet-labeled protein)
PDB Compounds: (B:) dom34

SCOPe Domain Sequences for d2vgnb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vgnb3 d.79.3.2 (B:278-381) Dom34 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
skeimvmdefllhlnkdddkawygekevvkaaeygaisyllltdkvlhsdniaqreeylk
lmdsvesnggkalvlstlhslgeeldqltgiacilkyplpdlde

SCOPe Domain Coordinates for d2vgnb3:

Click to download the PDB-style file with coordinates for d2vgnb3.
(The format of our PDB-style files is described here.)

Timeline for d2vgnb3: