Lineage for d2v9va1 (2v9v A:377-437)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2692959Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2693985Family a.4.5.35: C-terminal fragment of elongation factor SelB [74683] (2 proteins)
  6. 2694010Protein automated matches [254632] (1 species)
    not a true protein
  7. 2694011Species Moorella thermoacetica [TaxId:1525] [255606] (1 PDB entry)
  8. 2694012Domain d2v9va1: 2v9v A:377-437 [152809]
    automated match to d2v9va1
    complexed with cl, na

Details for d2v9va1

PDB Entry: 2v9v (more details), 1.1 Å

PDB Description: crystal structure of moorella thermoacetica selb(377-511)
PDB Compounds: (A:) Selenocysteine-specific elongation factor

SCOPe Domain Sequences for d2v9va1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2v9va1 a.4.5.35 (A:377-437) automated matches {Moorella thermoacetica [TaxId: 1525]}
gspekilaqiiqehregldwqeaatraslsleetrkllqsmaaagqvtllrvendlyais
t

SCOPe Domain Coordinates for d2v9va1:

Click to download the PDB-style file with coordinates for d2v9va1.
(The format of our PDB-style files is described here.)

Timeline for d2v9va1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2v9va2