Class a: All alpha proteins [46456] (290 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) contains a small beta-sheet (wing) |
Family a.4.5.35: C-terminal fragment of elongation factor SelB [74683] (2 proteins) |
Protein automated matches [254632] (1 species) not a true protein |
Species Moorella thermoacetica [TaxId:1525] [255606] (1 PDB entry) |
Domain d2v9va1: 2v9v A:377-437 [152809] automated match to d2v9va1 complexed with cl, na |
PDB Entry: 2v9v (more details), 1.1 Å
SCOPe Domain Sequences for d2v9va1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2v9va1 a.4.5.35 (A:377-437) automated matches {Moorella thermoacetica [TaxId: 1525]} gspekilaqiiqehregldwqeaatraslsleetrkllqsmaaagqvtllrvendlyais t
Timeline for d2v9va1: