Lineage for d2v8oa1 (2v8o A:176-320)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
3 layers: a/b/a, parallel or mixed beta-sheets of variable sizesSuperfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) 
division into families based on beta-sheet topologies
Family c.37.1.0: automated matches [191323] (1 protein)
not a true familyProtein automated matches [190123] (158 species)
not a true protein
Species Murray valley encephalitis virus [TaxId:11079] [231315] (1 PDB entry) 
Domain d2v8oa1: 2v8o A:176-320 [231316]
automated match to d1yksa1
Details for d2v8oa1
PDB Entry: 2v8o (more details), 1.9 Å
PDB Description: structure of the murray valley encephalitis virus rna helicase to 1. 9a resolution
PDB Compounds: (A:) flavivirin protease ns3SCOPe Domain Sequences for d2v8oa1:
Sequence, based on SEQRES records: (download)
>d2v8oa1 c.37.1.0 (A:176-320) automated matches {Murray valley encephalitis virus [TaxId: 11079]}
gpaynpemlkkrqltvldlhpgagktrrilpqiikdaiqkrlrtavlaptrvvaaemaea
lrglpvryltpavqrehsgneivdvmchatlthrlmsplrvpnynlfvmdeahftdpasi
aargyiatrveageaaaifmtatpp
Sequence, based on observed residues (ATOM records): (download)
>d2v8oa1 c.37.1.0 (A:176-320) automated matches {Murray valley encephalitis virus [TaxId: 11079]}
gpaynpemlkkrqltvldlhpgagktrrilpqiikdaiqkrlrtavlaptrvvaaemaea
lrglpvryltprehsgneivdvmchatlthrlmsplrvpnynlfvmdeahftdpasiaar
gyiatrveageaaaifmtatpp
SCOPe Domain Coordinates for d2v8oa1:
Click to download the PDB-style file with coordinates for d2v8oa1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2v8oa1:
- d2v8oa1 first appeared in SCOPe 2.03
- d2v8oa1 appears in SCOPe 2.07
View in 3D
