Lineage for d2v5ca3 (2v5c A:496-624)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2738194Fold a.246: Hyaluronidase domain-like [140656] (3 superfamilies)
    5 helices; bundle, closed, left-handed twist; up-and-down (meander) topology
  4. 2738195Superfamily a.246.1: Hyaluronidase post-catalytic domain-like [140657] (2 families) (S)
  5. 2738196Family a.246.1.1: Hyaluronidase post-catalytic domain-like [140658] (2 proteins)
  6. 2738211Protein Hyaluronidase, post-catalytic domain 3 [140659] (1 species)
  7. 2738212Species Clostridium perfringens [TaxId:1502] [140660] (7 PDB entries)
    Uniprot Q8XL08 496-624
  8. 2738213Domain d2v5ca3: 2v5c A:496-624 [206231]
    Other proteins in same PDB: d2v5ca1, d2v5ca2, d2v5cb1, d2v5cb2
    automated match to d2cbia1
    complexed with ca, cac, na

Details for d2v5ca3

PDB Entry: 2v5c (more details), 2.1 Å

PDB Description: family 84 glycoside hydrolase from clostridium perfringens, 2.1 angstrom structure
PDB Compounds: (A:) O-GlcNAcase nagJ

SCOPe Domain Sequences for d2v5ca3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2v5ca3 a.246.1.1 (A:496-624) Hyaluronidase, post-catalytic domain 3 {Clostridium perfringens [TaxId: 1502]}
edapelrakmdelwnklsskedasalieelygefarmeeacnnlkanlpevaleecsrql
delitlaqgdkasldmivaqlnedteayesakeiaqnklntalssfavisekvaqsfiqe
alsfdltli

SCOPe Domain Coordinates for d2v5ca3:

Click to download the PDB-style file with coordinates for d2v5ca3.
(The format of our PDB-style files is described here.)

Timeline for d2v5ca3: