Lineage for d2v3va1 (2v3v A:601-723)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.52: Double psi beta-barrel [50684] (2 superfamilies)
barrel, closed; n=6, S=10; complex topology with crossover (psi) loops
Superfamily b.52.2: ADC-like [50692] (4 families) 
Family b.52.2.0: automated matches [191648] (1 protein)
not a true familyProtein automated matches [191195] (10 species)
not a true protein
Species Desulfovibrio desulfuricans [TaxId:876] [255266] (3 PDB entries) 
Domain d2v3va1: 2v3v A:601-723 [152463]
Other proteins in same PDB: d2v3va2
automated match to d2v3va1
complexed with lcp, mgd, mo, sf4, unx
Details for d2v3va1
PDB Entry: 2v3v (more details), 1.99 Å
PDB Description: a new catalytic mechanism of periplasmic nitrate reductase from desulfovibrio desulfuricans atcc 27774 from crystallographic and epr data and based on detailed analysis of the sixth ligand
PDB Compounds: (A:) periplasmic nitrate reductaseSCOPe Domain Sequences for d2v3va1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2v3va1 b.52.2.0 (A:601-723) automated matches {Desulfovibrio desulfuricans [TaxId: 876]}
aaeepdaeyplyltsmrvidhwhtatmtgkvpelqkanpiafveineedaartgikhgds
vivetrrdamelparvsdvcrpgliavpffdpkklvnklfldatdpvsrepeykicaarv
rka
SCOPe Domain Coordinates for d2v3va1:
Click to download the PDB-style file with coordinates for d2v3va1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2v3va1:
- d2v3va1 first appeared in SCOP 1.75
- d2v3va1 appears in SCOPe 2.07
View in 3D
