Lineage for d2uuta_ (2uut A:)

  1. Root: SCOPe 2.07
  2. 2618030Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2622069Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
    divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members
  4. 2622070Superfamily e.8.1: DNA/RNA polymerases [56672] (8 families) (S)
    "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain
  5. 2623861Family e.8.1.0: automated matches [227142] (1 protein)
    not a true family
  6. 2623862Protein automated matches [226844] (11 species)
    not a true protein
  7. 2623914Species Sapporo virus [TaxId:95342] [231278] (4 PDB entries)
  8. 2623916Domain d2uuta_: 2uut A: [231279]
    automated match to d3qida_
    mutant

Details for d2uuta_

PDB Entry: 2uut (more details), 2.4 Å

PDB Description: the 2.4 angstrom resolution structure of the d346g mutant of the sapporo virus rdrp polymerase
PDB Compounds: (A:) RNA-directed RNA polymerase

SCOPe Domain Sequences for d2uuta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2uuta_ e.8.1.0 (A:) automated matches {Sapporo virus [TaxId: 95342]}
defqwkglpvvksgldvggmptgtryhrspawpeeqpgethapapfgsgdkrytfsqtem
lvnglkpyteptagvppqllsravthvrsyietiigthrspvltyhqacellerttscgp
fvqglkgdywdeeqqqytgvlanhleqawdkankgiaprnayklalkdelrpieknkagk
rrllwgcdaattliataafkavatrlqvvtpmtpvavginmdsvqmqvmndslkggvlyc
ldyskwdstqnpavtaaslailerfaephpivscaiealsspaegyvndikfvtrgglps
gmpftsvvnsinhmiyvaaailqayeshnvpytgnvfqvetihtyggdcmysvcpatasi
fhtvlanltsyglkptaikptntpvflkrtftqtphgirallditsitrqfywlkanrts
dpssppafdrqarsaqlenalayasqhgpvmfdtvrqiaiktaqgeglvlvntnydqala
tynawfiggtpd

SCOPe Domain Coordinates for d2uuta_:

Click to download the PDB-style file with coordinates for d2uuta_.
(The format of our PDB-style files is described here.)

Timeline for d2uuta_: