Lineage for d2tssa2 (2tss A:94-194)
- Root: SCOPe 2.05
Class d: Alpha and beta proteins (a+b) [53931] (381 folds) 
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (2 families) 
Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (16 proteins) 
Protein Toxic shock syndrome toxin-1 (TSST-1) [54340] (2 species) Species Staphylococcus aureus [TaxId:1280] [54341] (12 PDB entries) 
Domain d2tssa2: 2tss A:94-194 [37750]
Other proteins in same PDB: d2tssa1, d2tssb1, d2tssc1
Details for d2tssa2
PDB Entry: 2tss (more details), 2.05 Å
PDB Description: toxic shock syndrome toxin-1 from staphylococcus aureus: orthorhombicc222(1) crystal form
PDB Compounds: (A:) toxic shock syndrome toxin-1SCOPe Domain Sequences for d2tssa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2tssa2 d.15.6.1 (A:94-194) Toxic shock syndrome toxin-1 (TSST-1) {Staphylococcus aureus [TaxId: 1280]}
lptpielplkvkvhgkdsplkywpkfdkkqlaistldfeirhqltqihglyrssdktggy
wkitmndgstyqsdlskkfeyntekppinideiktieaein
SCOPe Domain Coordinates for d2tssa2:
Click to download the PDB-style file with coordinates for d2tssa2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2tssa2:
- d2tssa2 first appeared (with stable ids) in SCOP 1.55
- d2tssa2 appears in SCOPe 2.04
- d2tssa2 appears in SCOPe 2.06
- d2tssa2 appears in the current release, SCOPe 2.08
 View in 3DDomains from other chains: (mouse over for more information) d2tssb1, d2tssb2, d2tssc1, d2tssc2 |
