| Class a: All alpha proteins [46456] (284 folds) |
| Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.1: Homeodomain-like [46689] (20 families) ![]() consists only of helices |
| Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (35 proteins) |
| Protein Tetracyclin repressor (Tet-repressor, TetR) [46765] (1 species) |
| Species Escherichia coli [TaxId:562] [46766] (25 PDB entries) |
| Domain d2tcta1: 2tct A:2-67 [16063] Other proteins in same PDB: d2tcta2 complexed with ctc, mg |
PDB Entry: 2tct (more details), 2.1 Å
SCOPe Domain Sequences for d2tcta1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2tcta1 a.4.1.9 (A:2-67) Tetracyclin repressor (Tet-repressor, TetR) {Escherichia coli [TaxId: 562]}
arlnresvidaalellnetgidglttrklaqklgieqptlywhvknkralldalaveila
rhhdys
Timeline for d2tcta1: