Lineage for d2snwa_ (2snw A:)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
barrel, closed; n=6, S=8; greek-key
duplication: consists of two domains of the same foldSuperfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) 
Family b.47.1.3: Viral proteases [50596] (5 proteins)
beta sheet in the first domain is opened rather than forms a barrel
Protein Viral capsid protein [50597] (3 species) Species Sindbis virus [TaxId:11034] [50598] (11 PDB entries) 
Domain d2snwa_: 2snw A: [26381]
Details for d2snwa_
PDB Entry: 2snw (more details), 2.7 Å
PDB Description: sindbis virus capsid protein, type3 crystal form
PDB Compounds: (A:) coat protein cSCOPe Domain Sequences for d2snwa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2snwa_ b.47.1.3 (A:) Viral capsid protein {Sindbis virus [TaxId: 11034]}
alkleadrlfdvknedgdvighalamegkvmkplhvkgtidhpvlsklkftkssaydmef
aqlpvnmrseaftytsehpegfynwhhgavqysggrftiprgvggrgdsgrpimdnsgrv
vaivlggadegtrtalsvvtwnskgktikttpegteew
SCOPe Domain Coordinates for d2snwa_:
Click to download the PDB-style file with coordinates for d2snwa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2snwa_:
- d2snwa_ first appeared (with stable ids) in SCOP 1.55
- d2snwa_ appears in SCOPe 2.07
View in 3D
