Lineage for d2rusb2 (2rus B:3-137)
- Root: SCOPe 2.05
Class d: Alpha and beta proteins (a+b) [53931] (381 folds) 
Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (2 families) 
C-terminal domain is beta/alpha barrelFamily d.58.9.1: Ribulose 1,5-bisphosphate carboxylase-oxygenase [54967] (1 protein) Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [54968] (12 species) 
Species Rhodospirillum rubrum [TaxId:1085] [54974] (5 PDB entries) 
Domain d2rusb2: 2rus B:3-137 [39291]
Other proteins in same PDB: d2rusa1, d2rusb1
complexed with for, mg
Details for d2rusb2
PDB Entry: 2rus (more details), 2.3 Å
PDB Description: crystal structure of the ternary complex of ribulose-1,5-bisphosphate carboxylase, mg(ii), and activator co2 at 2.3-angstroms resolution
PDB Compounds: (B:) rubisco (ribulose-1,5-bisphosphate carboxylase(slash)oxygenase)SCOPe Domain Sequences for d2rusb2:
Sequence, based on SEQRES records: (download)
>d2rusb2 d.58.9.1 (B:3-137) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Rhodospirillum rubrum [TaxId: 1085]}
qssryvnlalkeedliaggehvlcayimkpkagygyvataahfaaesstgtnvevcttdd
ftrgvdalvyevdeareltkiaypvalfdrnitdgkamiasfltltmgnnqgmgdveyak
mhdfyvpeayralfd
Sequence, based on observed residues (ATOM records): (download)
>d2rusb2 d.58.9.1 (B:3-137) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Rhodospirillum rubrum [TaxId: 1085]}
qssryvnlalkeedliaggehvlcayimkpkagygyvataahfaaesstgtntrgvdalv
yevdeareltkiaypvalfdrnitdgkamiasfltltmgnnqgmgdveyakmhdfyvpea
yralfd
SCOPe Domain Coordinates for d2rusb2:
Click to download the PDB-style file with coordinates for d2rusb2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2rusb2:
- d2rusb2 first appeared (with stable ids) in SCOP 1.55
- d2rusb2 appears in SCOPe 2.04
- d2rusb2 appears in SCOPe 2.06
- d2rusb2 appears in the current release, SCOPe 2.08
View in 3D
