Lineage for d2rgda1 (2rgd A:1-166)
- Root: SCOP 1.75
Class c: Alpha and beta proteins (a/b) [51349] (147 folds) 
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
3 layers: a/b/a, parallel or mixed beta-sheets of variable sizesSuperfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families) 
division into families based on beta-sheet topologies
Family c.37.1.8: G proteins [52592] (78 proteins)
core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
Protein cH-p21 Ras protein [52593] (1 species) Species Human (Homo sapiens) [TaxId:9606] [52594] (56 PDB entries)
Uniprot Q6P716
Domain d2rgda1: 2rgd A:1-166 [152010]
automatically matched to d721pa_
complexed with ca, gnp, mg; mutant
Details for d2rgda1
PDB Entry: 2rgd (more details), 2 Å
PDB Description: crystal structure of h-rasq61l-gppnhp
PDB Compounds: (A:) gtpase hrasSCOP Domain Sequences for d2rgda1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2rgda1 c.37.1.8 (A:1-166) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]}
mteyklvvvgaggvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldildtag
leeysamrdqymrtgegflcvfainntksfedihqyreqikrvkdsddvpmvlvgnkcdl
aartvesrqaqdlarsygipyietsaktrqgvedafytlvreirqh
SCOP Domain Coordinates for d2rgda1:
Click to download the PDB-style file with coordinates for d2rgda1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2rgda1:
- d2rgda1 is new in SCOP 1.75
- d2rgda1 is called d2rgda_ in SCOPe 2.01
- d2rgda1 appears in the current release, SCOPe 2.08, called d2rgda_
View in 3D