Lineage for d2reza_ (2rez A:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1218105Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 1218323Superfamily d.129.3: Bet v1-like [55961] (11 families) (S)
    contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix
  5. 1218513Family d.129.3.6: oligoketide cyclase/dehydrase-like [118101] (4 proteins)
    Pfam PF03654
  6. 1218520Protein Multifunctional enzyme TcmN, cyclase/aromatase domain [160740] (1 species)
  7. 1218521Species Streptomyces glaucescens [TaxId:1907] [160741] (4 PDB entries)
    Uniprot P16559 1-152! Uniprot P16559 1-155
  8. 1218524Domain d2reza_: 2rez A: [151992]
    automated match to d2rera1
    complexed with act, iod

Details for d2reza_

PDB Entry: 2rez (more details), 1.95 Å

PDB Description: Tetracenomycin ARO/CYC NaI Structure
PDB Compounds: (A:) Multifunctional cyclase-dehydratase-3-O-methyl transferase tcmN

SCOPe Domain Sequences for d2reza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2reza_ d.129.3.6 (A:) Multifunctional enzyme TcmN, cyclase/aromatase domain {Streptomyces glaucescens [TaxId: 1907]}
gshmaartdnsivvnapfelvwdvtndieawpelfseyaeaeilrqdgdgfdfrlktrpd
angrvwewvshrvpdkgsrtvrahrvetgpfaymnlhwtyravaggtemrwvqefdmkpg
apfdnahmtahlntttranmerikkiiedrhregq

SCOPe Domain Coordinates for d2reza_:

Click to download the PDB-style file with coordinates for d2reza_.
(The format of our PDB-style files is described here.)

Timeline for d2reza_: