Lineage for d2raob_ (2rao B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2685878Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2685879Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2685963Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 2688401Protein automated matches [190359] (43 species)
    not a true protein
  7. 2688778Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [188592] (1 PDB entry)
  8. 2688780Domain d2raob_: 2rao B: [168032]
    automated match to d1aj9b_
    complexed with hem, oxy

Details for d2raob_

PDB Entry: 2rao (more details), 2 Å

PDB Description: x ray crystal structure of rabbit hemoglobin (oxy form) at 2.0 angstrom resolution
PDB Compounds: (B:) Hemoglobin subunit beta-1/2

SCOPe Domain Sequences for d2raob_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2raob_ a.1.1.2 (B:) automated matches {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
vhlsseeksavtalwgkvnveevggealgrllvvypwtqrffesfgdlssanavmnnpkv
kahgkkvlaafseglshldnlkgtfaklselhcdklhvdpenfrllgnvlvivlshhfgk
eftpqvqaayqkvvagvanalahkyh

SCOPe Domain Coordinates for d2raob_:

Click to download the PDB-style file with coordinates for d2raob_.
(The format of our PDB-style files is described here.)

Timeline for d2raob_: