Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.48: TK C-terminal domain-like [52921] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 13245, strand 1 is antiparallel to the rest |
Superfamily c.48.1: TK C-terminal domain-like [52922] (4 families) |
Family c.48.1.1: Transketolase C-terminal domain-like [52923] (2 proteins) |
Protein Transketolase (TK), C-domain [52924] (4 species) two N-terminal domains are PP and Pyr modules of thiamin-binding fold |
Species Escherichia coli [TaxId:562] [89712] (4 PDB entries) |
Domain d2r8oa3: 2r8o A:528-663 [151733] Other proteins in same PDB: d2r8oa1, d2r8oa2, d2r8ob1, d2r8ob2 automated match to d2r8oa3 complexed with ca, edo, t5x |
PDB Entry: 2r8o (more details), 1.47 Å
SCOPe Domain Sequences for d2r8oa3:
Sequence; same for both SEQRES and ATOM records: (download)
>d2r8oa3 c.48.1.1 (A:528-663) Transketolase (TK), C-domain {Escherichia coli [TaxId: 562]} rteeqlaniarggyvlkdcagqpelifiatgsevelavaayekltaegvkarvvsmpstd afdkqdaayresvlpkavtarvaveagiadywykyvglngaivgmttfgesapaellfee fgftvdnvvakakell
Timeline for d2r8oa3: