| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465 |
Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families) ![]() there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules |
| Family c.36.1.0: automated matches [227300] (1 protein) not a true family |
| Protein automated matches [227126] (20 species) not a true protein |
| Species Escherichia coli K-12 [TaxId:83333] [255577] (2 PDB entries) |
| Domain d2r8oa1: 2r8o A:333-527 [151731] Other proteins in same PDB: d2r8oa2, d2r8oa3, d2r8ob2, d2r8ob3, d2r8ob4 automated match to d2r8oa1 complexed with ca, edo, t5x |
PDB Entry: 2r8o (more details), 1.47 Å
SCOPe Domain Sequences for d2r8oa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2r8oa1 c.36.1.0 (A:333-527) automated matches {Escherichia coli K-12 [TaxId: 83333]}
mpsdfdakakefiaklqanpakiasrkasqnaieafgpllpeflggsadlapsnltlwsg
skainedaagnyihygvrefgmtaiangislhggflpytstflmfveyarnavrmaalmk
qrqvmvythdsiglgedgpthqpveqvaslrvtpnmstwrpcdqvesavawkygverqdg
ptalilsrqnlaqqe
Timeline for d2r8oa1:
View in 3DDomains from other chains: (mouse over for more information) d2r8ob1, d2r8ob2, d2r8ob3, d2r8ob4 |