Lineage for d2r6na1 (2r6n A:1-215)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1191813Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 1191814Superfamily d.3.1: Cysteine proteinases [54001] (23 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 1191815Family d.3.1.1: Papain-like [54002] (26 proteins)
  6. 1191841Protein (Pro)cathepsin K [54028] (2 species)
  7. 1191842Species Human (Homo sapiens) [TaxId:9606] [54029] (39 PDB entries)
    Uniprot P43235 116-329 ! Uniprot P43235 115-329
  8. 1191854Domain d2r6na1: 2r6n A:1-215 [151620]
    automatically matched to d1atka_
    complexed with cke

Details for d2r6na1

PDB Entry: 2r6n (more details), 1.95 Å

PDB Description: crystal structure of a pyrrolopyrimidine inhibitor in complex with human cathepsin k
PDB Compounds: (A:) cathepsin k

SCOPe Domain Sequences for d2r6na1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2r6na1 d.3.1.1 (A:1-215) (Pro)cathepsin K {Human (Homo sapiens) [TaxId: 9606]}
apdsvdyrkkgyvtpvknqgqcgscwafssvgalegqlkkktgkllnlspqnlvdcvsen
dgcgggymtnafqyvqknrgidsedaypyvgqeescmynptgkaakcrgyreipegneka
lkravarvgpvsvaidasltsfqfyskgvyydescnsdnlnhavlavgygiqkgnkhwii
knswgenwgnkgyilmarnknnacgianlasfpkm

SCOPe Domain Coordinates for d2r6na1:

Click to download the PDB-style file with coordinates for d2r6na1.
(The format of our PDB-style files is described here.)

Timeline for d2r6na1: