Lineage for d2qykb_ (2qyk B:)
- Root: SCOPe 2.05
Class a: All alpha proteins [46456] (286 folds) 
Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
multihelical; consists of two different alpha-helical bundlesSuperfamily a.211.1: HD-domain/PDEase-like [109604] (6 families) 
Family a.211.1.2: PDEase [48548] (7 proteins)
Pfam PF00233; multihelical; can be divided into three subdomains
Protein automated matches [190370] (1 species)
not a true proteinSpecies Human (Homo sapiens) [TaxId:9606] [187208] (26 PDB entries) 
Domain d2qykb_: 2qyk B: [167885]
automated match to d1oyna_
complexed with mg, npv, zn
Details for d2qykb_
PDB Entry: 2qyk (more details), 2.1 Å
PDB Description: Crystal structure of PDE4A10 in complex with inhibitor NPV
PDB Compounds: (B:) Cyclic AMP-specific phosphodiesterase HSPDE4A10SCOPe Domain Sequences for d2qykb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qykb_ a.211.1.2 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
hmniprfgvktdqeellaqelenlnkwglnifcvsdyaggrsltcimymifqerdllkkf
ripvdtmvtymltledhyhadvayhnslhaadvlqsthvllatpaldavftdleilaalf
aaaihdvdhpgvsnqflintnselalmyndesvlenhhlavgfkllqedncdifqnlskr
qrqslrkmvidmvlatdmskhmtlladlktmvetkkvtssgvllldnysdriqvlrnmvh
cadlsnptkplelyrqwtdrimaeffqqgdrerergmeispmcdkhtasveksqvgfidy
ivhplwetwadlvhpdaqeildtlednrdwyysai
SCOPe Domain Coordinates for d2qykb_:
Click to download the PDB-style file with coordinates for d2qykb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2qykb_:
- d2qykb_ first appeared in SCOPe 2.01
- d2qykb_ appears in SCOPe 2.04
- d2qykb_ is called d2qykb1 in SCOPe 2.06
- d2qykb_ appears in the current release, SCOPe 2.08, called d2qykb1
View in 3D
