Lineage for d2qpdb2 (2qpd B:3-36)
- Root: SCOPe 2.04
Class f: Membrane and cell surface proteins and peptides [56835] (57 folds) 
Fold f.17: Transmembrane helix hairpin [81334] (5 superfamilies)
two antiparallel transmembrane helicesSuperfamily f.17.2: Cytochrome c oxidase subunit II-like, transmembrane region [81464] (2 families) 
Family f.17.2.1: Cytochrome c oxidase subunit II-like, transmembrane region [81463] (5 proteins) Protein Bacterial ba3 type cytochrome c oxidase subunit II [81460] (1 species) Species Thermus thermophilus [TaxId:274] [81459] (19 PDB entries)
the "missing" first helix is complemented by the ba3 subunit IIa
Domain d2qpdb2: 2qpd B:3-36 [151200]
Other proteins in same PDB: d2qpdb1, d2qpdc1
automatically matched to d1ehkb2
complexed with cu1, cua, has, hem
Details for d2qpdb2
PDB Entry: 2qpd (more details), 3.25 Å
PDB Description: an unexpected outcome of surface-engineering an integral membrane protein: improved crystallization of cytochrome ba3 oxidase from thermus thermophilus
PDB Compounds: (B:) Cytochrome c oxidase subunit 2SCOPe Domain Sequences for d2qpdb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qpdb2 f.17.2.1 (B:3-36) Bacterial ba3 type cytochrome c oxidase subunit II {Thermus thermophilus [TaxId: 274]}
dehkahkailayekgwlafslamlfvfialiayt
SCOPe Domain Coordinates for d2qpdb2:
Click to download the PDB-style file with coordinates for d2qpdb2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2qpdb2:
- d2qpdb2 first appeared in SCOP 1.75
- d2qpdb2 appears in SCOPe 2.03
- d2qpdb2 appears in SCOPe 2.05
- d2qpdb2 appears in the current release, SCOPe 2.08
View in 3D
