Lineage for d2qlxa_ (2qlx A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1906287Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1906842Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families) (S)
    dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers
  5. 1907207Family d.58.4.0: automated matches [191316] (1 protein)
    not a true family
  6. 1907208Protein automated matches [190081] (21 species)
    not a true protein
  7. 1907318Species Rhizobium leguminosarum [TaxId:386] [188716] (2 PDB entries)
  8. 1907321Domain d2qlxa_: 2qlx A: [167718]
    automated match to d1x8da1
    complexed with fmt, mg, rm4

Details for d2qlxa_

PDB Entry: 2qlx (more details), 2 Å

PDB Description: crystal structure of rhamnose mutarotase rhau of rhizobium leguminosarum in complex with l-rhamnose
PDB Compounds: (A:) L-rhamnose mutarotase

SCOPe Domain Sequences for d2qlxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qlxa_ d.58.4.0 (A:) automated matches {Rhizobium leguminosarum [TaxId: 386]}
gdmtlekhafkmqlnpgmeaeyrkrhdeiwpelvdllhqsgasdysihldretntlfgvl
trpkdhtmaslpdhpvmkkwwahmadimatnpdnspvqsdlvtlfhmp

SCOPe Domain Coordinates for d2qlxa_:

Click to download the PDB-style file with coordinates for d2qlxa_.
(The format of our PDB-style files is described here.)

Timeline for d2qlxa_: