Lineage for d2qcza1 (2qcz A:22-91)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3012169Fold d.391: POlypeptide TRansport Associated (PORTRA) domain-like [310567] (1 superfamily)
    beta-alpha(2)-beta(2); 2 layers, alpha/beta; mixed beta sheet, order 132
  4. 3012170Superfamily d.391.1: POlypeptide TRansport Associated (PORTRA) domain-like [310598] (2 families) (S)
    Pfam PF07244
  5. 3012171Family d.391.1.1: POlypeptide TRansport Associated (PORTRA) domain [310646] (3 proteins)
  6. 3012175Protein YaeT [310792] (1 species)
  7. 3012176Species Escherichia coli K-12 [TaxId:83333] [311050] (2 PDB entries)
  8. 3012181Domain d2qcza1: 2qcz A:22-91 [304397]

Details for d2qcza1

PDB Entry: 2qcz (more details), 2.7 Å

PDB Description: structure of n-terminal domain of e. coli yaet
PDB Compounds: (A:) Outer membrane protein assembly factor yaeT

SCOPe Domain Sequences for d2qcza1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qcza1 d.391.1.1 (A:22-91) YaeT {Escherichia coli K-12 [TaxId: 83333]}
egfvvkdihfeglqrvavgaallsmpvrtgdtvndedisntiralfatgnfedvrvlrdg
dtllvqvker

SCOPe Domain Coordinates for d2qcza1:

Click to download the PDB-style file with coordinates for d2qcza1.
(The format of our PDB-style files is described here.)

Timeline for d2qcza1: