Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.391: POlypeptide TRansport Associated (PORTRA) domain-like [310567] (1 superfamily) beta-alpha(2)-beta(2); 2 layers, alpha/beta; mixed beta sheet, order 132 |
Superfamily d.391.1: POlypeptide TRansport Associated (PORTRA) domain-like [310598] (2 families) Pfam PF07244 |
Family d.391.1.1: POlypeptide TRansport Associated (PORTRA) domain [310646] (3 proteins) |
Protein YaeT [310792] (1 species) |
Species Escherichia coli K-12 [TaxId:83333] [311050] (2 PDB entries) |
Domain d2qcza1: 2qcz A:22-91 [304397] |
PDB Entry: 2qcz (more details), 2.7 Å
SCOPe Domain Sequences for d2qcza1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2qcza1 d.391.1.1 (A:22-91) YaeT {Escherichia coli K-12 [TaxId: 83333]} egfvvkdihfeglqrvavgaallsmpvrtgdtvndedisntiralfatgnfedvrvlrdg dtllvqvker
Timeline for d2qcza1:
View in 3D Domains from other chains: (mouse over for more information) d2qczb1, d2qczb2, d2qczb3, d2qczb4 |