Lineage for d2q13a2 (2q13 A:274-378)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2803065Fold b.55: PH domain-like barrel [50728] (3 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 2803066Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 2803713Family b.55.1.0: automated matches [191311] (1 protein)
    not a true family
  6. 2803714Protein automated matches [190052] (8 species)
    not a true protein
  7. 2803789Species Human (Homo sapiens) [TaxId:9606] [186914] (120 PDB entries)
  8. 2803846Domain d2q13a2: 2q13 A:274-378 [231190]
    Other proteins in same PDB: d2q13a1, d2q13a3
    automated match to d2elba2

Details for d2q13a2

PDB Entry: 2q13 (more details), 2.05 Å

PDB Description: Crystal structure of BAR-PH domain of APPL1
PDB Compounds: (A:) DCC-interacting protein 13 alpha

SCOPe Domain Sequences for d2q13a2:

Sequence, based on SEQRES records: (download)

>d2q13a2 b.55.1.0 (A:274-378) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nrnltrkagylnarnktglvsstwdrqfyftqggnlmsqargdvagglamdidncsvmav
dcedrrycfqitsfdgkkssilqaeskkdheewictinniskqiy

Sequence, based on observed residues (ATOM records): (download)

>d2q13a2 b.55.1.0 (A:274-378) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nrnltrkagylnartwdrqfyftqggnlmsqargdvagglamdidncsvmavdcedrryc
fqitsfdgkkssilqaeskkdheewictinniskqiy

SCOPe Domain Coordinates for d2q13a2:

Click to download the PDB-style file with coordinates for d2q13a2.
(The format of our PDB-style files is described here.)

Timeline for d2q13a2: