Lineage for d2pyfa2 (2pyf A:116-205)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1758822Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1762660Protein automated matches [190374] (14 species)
    not a true protein
  7. 1762816Species Human (Homo sapiens) [TaxId:9606] [187221] (409 PDB entries)
  8. 1762986Domain d2pyfa2: 2pyf A:116-205 [205693]
    Other proteins in same PDB: d2pyfa1, d2pyfb1
    automated match to d1qrnd2
    complexed with pg4, pge, so4

Details for d2pyfa2

PDB Entry: 2pyf (more details), 2.2 Å

PDB Description: Crystal Structures of High Affinity Human T-Cell Receptors Bound to pMHC RevealNative Diagonal Binding Geometry Unbound TCR Clone 5-1
PDB Compounds: (A:) T-cell receptor, alpha chain

SCOPe Domain Sequences for d2pyfa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pyfa2 b.1.1.2 (A:116-205) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnksdfacanafnnsiipdtffpspe

SCOPe Domain Coordinates for d2pyfa2:

Click to download the PDB-style file with coordinates for d2pyfa2.
(The format of our PDB-style files is described here.)

Timeline for d2pyfa2:

1762986
d2pyfa2 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d2pyfa1