Lineage for d2pw0a2 (2pw0 A:186-397)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.21: Diaminopimelate epimerase-like [54505] (1 superfamily)
mixed beta-sheet folds into a barrel (n=8, S=14) around the central helixSuperfamily d.21.1: Diaminopimelate epimerase-like [54506] (5 families) 
duplication: consists of two similar domain swapped with C-terminal strands
Family d.21.1.0: automated matches [191386] (1 protein)
not a true familyProtein automated matches [190491] (18 species)
not a true protein
Species Shewanella oneidensis [TaxId:70863] [225314] (3 PDB entries) 
Domain d2pw0a2: 2pw0 A:186-397 [205661]
automated match to d2h9fa2
complexed with edo, trc
Details for d2pw0a2
PDB Entry: 2pw0 (more details), 1.57 Å
PDB Description: crystal structure of trans-aconitate bound to methylaconitate isomerase prpf from shewanella oneidensis
PDB Compounds: (A:) PrpF methylaconitate isomeraseSCOPe Domain Sequences for d2pw0a2:
Sequence, based on SEQRES records: (download)
>d2pw0a2 d.21.1.0 (A:186-397) automated matches {Shewanella oneidensis [TaxId: 70863]}
adddgeggcmfptgnlvdvlevpgigrfnatminagiptifinaedlgytgtelqddins
dnaalakfetirahgalrmglikhideaasrqhtpkiafvappksyasssgktvaaedvd
llvralsmgklhhammgtaavaigtaaaipgtlvnlaagggekeavrfghpsgtlrvgaq
avqengewtvikaimsrsarvlmegfvrvpkp
Sequence, based on observed residues (ATOM records): (download)
>d2pw0a2 d.21.1.0 (A:186-397) automated matches {Shewanella oneidensis [TaxId: 70863]}
adcmfptgnlvdvlevpgigrfnatminagiptifinaedlgytgtelqddinsdnaala
kfetirahgalrmglikhideaasrqhtpkiafvappksyasssgktvaaedvdllvral
smgklhhammgtaavaigtaaaipgtlvnlaagggekeavrfghpsgtlrvgaqavqeng
ewtvikaimsrsarvlmegfvrvpkp
SCOPe Domain Coordinates for d2pw0a2:
Click to download the PDB-style file with coordinates for d2pw0a2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2pw0a2:
- d2pw0a2 first appeared in SCOPe 2.03
- d2pw0a2 appears in SCOPe 2.07
View in 3D
