Lineage for d2ptma_ (2ptm A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2080271Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2082002Superfamily b.82.3: cAMP-binding domain-like [51206] (4 families) (S)
  5. 2082008Family b.82.3.2: cAMP-binding domain [51210] (13 proteins)
    Pfam PF00027
  6. 2082153Protein automated matches [190352] (8 species)
    not a true protein
  7. 2082216Species Purple sea urchin (Strongylocentrotus purpuratus) [TaxId:7668] [188850] (1 PDB entry)
  8. 2082217Domain d2ptma_: 2ptm A: [167269]
    automated match to d1q5oa_
    complexed with cmp, nco

Details for d2ptma_

PDB Entry: 2ptm (more details), 1.93 Å

PDB Description: structure and rearrangements in the carboxy-terminal region of spih channels
PDB Compounds: (A:) Hyperpolarization-activated (Ih) channel

SCOPe Domain Sequences for d2ptma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ptma_ b.82.3.2 (A:) automated matches {Purple sea urchin (Strongylocentrotus purpuratus) [TaxId: 7668]}
dsssrqyreklkqveeymqyrklpshlrnkildyyeyryrgkmfderhifrevsesirqd
vanyncrdlvasvpffvgadsnfvtrvvtllefevfqpadyviqegtfgdrmffiqqgiv
diimsdgviatslsdgsyfgeiclltrerrvasvkcetyctlfslsvqhfnqvldefpam
rktmeeiavrrl

SCOPe Domain Coordinates for d2ptma_:

Click to download the PDB-style file with coordinates for d2ptma_.
(The format of our PDB-style files is described here.)

Timeline for d2ptma_: