Lineage for d2psmc1 (2psm C:3-71)

  1. Root: SCOPe 2.01
  2. 1061255Class g: Small proteins [56992] (90 folds)
  3. 1064241Fold g.18: Complement control module/SCR domain [57534] (1 superfamily)
    disulfide-rich all-beta fold
  4. 1064242Superfamily g.18.1: Complement control module/SCR domain [57535] (1 family) (S)
  5. 1064243Family g.18.1.1: Complement control module/SCR domain [57536] (15 proteins)
    Pfam PF00084
  6. 1064457Protein Interleukin-15 receptor subunit alpha [161139] (2 species)
  7. 1064470Species Mouse (Mus musculus) [TaxId:10090] [161140] (1 PDB entry)
    Uniprot Q60819 35-103
  8. 1064471Domain d2psmc1: 2psm C:3-71 [149822]
    Other proteins in same PDB: d2psma1, d2psmb_
    complexed with bam

Details for d2psmc1

PDB Entry: 2psm (more details), 2.19 Å

PDB Description: crystal structure of interleukin 15 in complex with interleukin 15 receptor alpha
PDB Compounds: (C:) Interleukin-15 receptor alpha chain

SCOPe Domain Sequences for d2psmc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2psmc1 g.18.1.1 (C:3-71) Interleukin-15 receptor subunit alpha {Mouse (Mus musculus) [TaxId: 10090]}
tcpppvsiehadirvknysvnsreryvcnsgfkrkagtstliecvinkntnvahwttpsl
kcirdpsla

SCOPe Domain Coordinates for d2psmc1:

Click to download the PDB-style file with coordinates for d2psmc1.
(The format of our PDB-style files is described here.)

Timeline for d2psmc1: