Lineage for d2psfa_ (2psf A:)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the restSuperfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) 
many members have left-handed crossover connection between strand 8 and additional strand 9
Family c.69.1.0: automated matches [191404] (1 protein)
not a true familyProtein automated matches [190543] (131 species)
not a true protein
Species Renilla reniformis [TaxId:6136] [225269] (7 PDB entries) 
Domain d2psfa_: 2psf A: [205626]
automated match to d2o2ha_
Details for d2psfa_
PDB Entry: 2psf (more details), 1.4 Å
PDB Description: crystal structures of the luciferase and green fluorescent protein from renilla reniformis
PDB Compounds: (A:) Renilla-luciferin 2-monooxygenaseSCOPe Domain Sequences for d2psfa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2psfa_ c.69.1.0 (A:) automated matches {Renilla reniformis [TaxId: 6136]}
skvydpeqrkrmitgpqwwarckqmnvldsfinyydsekhaenaviflhgnatssylwrh
vvphiepvarciipdligmgksgksgngsyrlldhykyltawfellnlpkkiifvghdwg
aalafhyayehqdrikaivhmesvvdvieswdewpdieedialikseegekmvlennffv
etvlpskimrklepeefaaylepfkekgevrrptlswpreiplvkggkpdvvqivrnyna
ylrasddlpklfiesdpgffsnaivegakkfpntefvkvkglhflqedapdemgkyiksf
vervlkn
SCOPe Domain Coordinates for d2psfa_:
Click to download the PDB-style file with coordinates for d2psfa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2psfa_:
- d2psfa_ first appeared in SCOPe 2.03
- d2psfa_ appears in SCOPe 2.07
View in 3D
