Lineage for d2pmta2 (2pmt A:1-80)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2876589Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins)
  6. 2876765Protein Class beta GST [81368] (4 species)
  7. 2876775Species Proteus mirabilis [TaxId:584] [52884] (2 PDB entries)
  8. 2876776Domain d2pmta2: 2pmt A:1-80 [33035]
    Other proteins in same PDB: d2pmta1, d2pmtb1, d2pmtc1, d2pmtd1
    complexed with gsh

Details for d2pmta2

PDB Entry: 2pmt (more details), 2.7 Å

PDB Description: glutathione transferase from proteus mirabilis
PDB Compounds: (A:) glutathione transferase

SCOPe Domain Sequences for d2pmta2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pmta2 c.47.1.5 (A:1-80) Class beta GST {Proteus mirabilis [TaxId: 584]}
mklyytpgscslsphivlretgldfsieridlrtkktesgkdflainpkgqvpvlqldng
diltegvaivqyladlkpdr

SCOPe Domain Coordinates for d2pmta2:

Click to download the PDB-style file with coordinates for d2pmta2.
(The format of our PDB-style files is described here.)

Timeline for d2pmta2: