Lineage for d2pmqa2 (2pmq A:126-367)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2089714Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2098969Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) (S)
    binds metal ion (magnesium or manganese) in conserved site inside barrel
    N-terminal alpha+beta domain is common to this superfamily
  5. 2099417Family c.1.11.0: automated matches [227196] (1 protein)
    not a true family
  6. 2099418Protein automated matches [226923] (74 species)
    not a true protein
  7. 2099902Species Roseovarius sp. [TaxId:314265] [231165] (1 PDB entry)
  8. 2099903Domain d2pmqa2: 2pmq A:126-367 [231166]
    Other proteins in same PDB: d2pmqa1, d2pmqa3, d2pmqb1, d2pmqb3
    automated match to d4mggf2
    complexed with mg

Details for d2pmqa2

PDB Entry: 2pmq (more details), 1.72 Å

PDB Description: crystal structure of a mandelate racemase/muconate lactonizing enzyme from roseovarius sp. htcc2601
PDB Compounds: (A:) Mandelate racemase/muconate lactonizing enzyme

SCOPe Domain Sequences for d2pmqa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pmqa2 c.1.11.0 (A:126-367) automated matches {Roseovarius sp. [TaxId: 314265]}
altdsvssyyslgvmepdeaarqalekqregysrlqvklgarpieidieairkvweavrg
tgialaadgnrgwttrdalrfsrecpdipfvmeqpcnsfedleairplchhalymdedgt
slntvitaaatslvdgfgmkvsrigglqhmrafrdfcaarnlphtcddawggdivsaact
hiastvlprlmegawlaqpyvaehydaengvrieggrirvpqgpglgltidperfgpplf
sa

SCOPe Domain Coordinates for d2pmqa2:

Click to download the PDB-style file with coordinates for d2pmqa2.
(The format of our PDB-style files is described here.)

Timeline for d2pmqa2: