Lineage for d2pmqa1 (2pmq A:2-125)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1649013Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 1649014Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 1649263Family d.54.1.0: automated matches [227195] (1 protein)
    not a true family
  6. 1649264Protein automated matches [226922] (67 species)
    not a true protein
  7. 1649667Species Roseovarius sp. [TaxId:314265] [231163] (1 PDB entry)
  8. 1649668Domain d2pmqa1: 2pmq A:2-125 [231164]
    Other proteins in same PDB: d2pmqa2, d2pmqb2
    automated match to d4mggf1
    complexed with mg

Details for d2pmqa1

PDB Entry: 2pmq (more details), 1.72 Å

PDB Description: crystal structure of a mandelate racemase/muconate lactonizing enzyme from roseovarius sp. htcc2601
PDB Compounds: (A:) Mandelate racemase/muconate lactonizing enzyme

SCOPe Domain Sequences for d2pmqa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pmqa1 d.54.1.0 (A:2-125) automated matches {Roseovarius sp. [TaxId: 314265]}
kiaeiqlfqhdlpvvngpyriasgdvwsltttivkiiaedgtigwgetcpvgptyaeaha
ggalaalevlasglagaealplplhtrmdsllcghnyaksaldiavhdlwgkrlgvpvhe
llgg

SCOPe Domain Coordinates for d2pmqa1:

Click to download the PDB-style file with coordinates for d2pmqa1.
(The format of our PDB-style files is described here.)

Timeline for d2pmqa1:

1649668
d2pmqa1 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d2pmqa2