Lineage for d2plaa1 (2pla A:4-195)
- Root: SCOPe 2.04
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
The nucleotide-binding modes of this and the next two folds/superfamilies are similarSuperfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) 
Family c.2.1.0: automated matches [191313] (1 protein)
not a true familyProtein automated matches [190069] (181 species)
not a true protein
Species Human (Homo sapiens) [TaxId:9606] [186944] (37 PDB entries) 
Domain d2plaa1: 2pla A:4-195 [231158]
Other proteins in same PDB: d2plaa2
automated match to d1wpqa1
complexed with cl, nad, po4
Details for d2plaa1
PDB Entry: 2pla (more details), 2.51 Å
PDB Description: crystal structure of human glycerol-3-phosphate dehydrogenase 1-like protein
PDB Compounds: (A:) Glycerol-3-phosphate dehydrogenase 1-like proteinSCOPe Domain Sequences for d2plaa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2plaa1 c.2.1.0 (A:4-195) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aplkvcivgsgnwgsavakiignnvkklqkfastvkmwvfeetvngrkltdiinndhenv
kylpghklpenvvamsnlseavqdadllvfviphqfihricdeitgrvpkkalgitlikg
idegpeglklisdiirekmgidisvlmganianevaaekfcettigskvmengllfkell
qtpnfritvvdd
SCOPe Domain Coordinates for d2plaa1:
Click to download the PDB-style file with coordinates for d2plaa1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2plaa1:
- d2plaa1 first appeared in SCOPe 2.03
- d2plaa1 appears in SCOPe 2.05
- d2plaa1 appears in the current release, SCOPe 2.08
View in 3D
