Lineage for d2ph3a_ (2ph3 A:)
- Root: SCOPe 2.05
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
The nucleotide-binding modes of this and the next two folds/superfamilies are similarSuperfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) 
Family c.2.1.0: automated matches [191313] (1 protein)
not a true familyProtein automated matches [190069] (203 species)
not a true protein
Species Thermus thermophilus HB8 [TaxId:300852] [187989] (16 PDB entries) 
Domain d2ph3a_: 2ph3 A: [167185]
automated match to d1i01a_
Details for d2ph3a_
PDB Entry: 2ph3 (more details), 1.91 Å
PDB Description: crystal structure of 3-oxoacyl-[acyl carrier protein] reductase ttha0415 from thermus thermophilus
PDB Compounds: (A:) 3-oxoacyl-[acyl carrier protein] reductaseSCOPe Domain Sequences for d2ph3a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ph3a_ c.2.1.0 (A:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
mrkalitgasrgigraialrlaedgfalaihygqnrekaeevaeearrrgsplvavlgan
lleaeaatalvhqaaevlggldtlvnnagitrdtllvrmkdedweavleanlsavfrttr
eavklmmkarfgrivnitsvvgilgnpgqanyvaskagligftravakeyaqrgitvnav
apgfietemterlpqevkeaylkqipagrfgrpeevaeavaflvsekagyitgqtlcvdg
gltph
SCOPe Domain Coordinates for d2ph3a_:
Click to download the PDB-style file with coordinates for d2ph3a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2ph3a_:
- d2ph3a_ first appeared in SCOPe 2.01
- d2ph3a_ appears in SCOPe 2.04
- d2ph3a_ appears in SCOPe 2.06
- d2ph3a_ appears in the current release, SCOPe 2.08
View in 3D
