Lineage for d2p8ba1 (2p8b A:1-125)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2191243Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 2191244Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 2191540Family d.54.1.0: automated matches [227195] (1 protein)
    not a true family
  6. 2191541Protein automated matches [226922] (88 species)
    not a true protein
  7. 2191618Species Bacillus cereus [TaxId:226900] [225289] (3 PDB entries)
  8. 2191619Domain d2p8ba1: 2p8b A:1-125 [205477]
    Other proteins in same PDB: d2p8ba2
    automated match to d1nu5a2
    complexed with mg, nsk

Details for d2p8ba1

PDB Entry: 2p8b (more details), 1.7 Å

PDB Description: Crystal structure of N-succinyl Arg/Lys racemase from Bacillus cereus ATCC 14579 complexed with N-succinyl Lys.
PDB Compounds: (A:) mandelate racemase/muconate lactonizing enzyme family protein

SCOPe Domain Sequences for d2p8ba1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2p8ba1 d.54.1.0 (A:1-125) automated matches {Bacillus cereus [TaxId: 226900]}
mkitaihlyairlplrnpfvisygsysdmpsiivkmetdegiigygegvaddhvtgeswe
stfhtlkhtltpaligqnpmniekihdmmdntiygvptakaaidiacfdimgkklnqpvy
qligg

SCOPe Domain Coordinates for d2p8ba1:

Click to download the PDB-style file with coordinates for d2p8ba1.
(The format of our PDB-style files is described here.)

Timeline for d2p8ba1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2p8ba2