Lineage for d2p7tc_ (2p7t C:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2629055Fold f.14: Gated ion channels [81325] (2 superfamilies)
    oligomeric transmembrane alpha-helical proteins
  4. 2629056Superfamily f.14.1: Voltage-gated ion channels [81324] (3 families) (S)
    Pfam PF00520
  5. 2629057Family f.14.1.1: Voltage-gated potassium channels [81323] (6 proteins)
  6. 2629078Protein Potassium channel protein [56901] (3 species)
  7. 2629129Species Streptomyces lividans [TaxId:1916] [161074] (28 PDB entries)
  8. 2629131Domain d2p7tc_: 2p7t C: [149291]
    Other proteins in same PDB: d2p7ta1, d2p7ta2, d2p7ta3, d2p7tb1, d2p7tb2
    automated match to d1k4cc_
    complexed with 1em, f09, k; mutant

Details for d2p7tc_

PDB Entry: 2p7t (more details), 2.05 Å

PDB Description: crystal structure of kcsa mutant
PDB Compounds: (C:) Voltage-gated potassium channel

SCOPe Domain Sequences for d2p7tc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2p7tc_ f.14.1.1 (C:) Potassium channel protein {Streptomyces lividans [TaxId: 1916]}
salhwraagaatvllvivllagsylavlaergapgaqlitypralwwsvstattvgygdl
ypvtlwgrcvavvvmvagitsfglvtaalatwfvgreqerrgh

SCOPe Domain Coordinates for d2p7tc_:

Click to download the PDB-style file with coordinates for d2p7tc_.
(The format of our PDB-style files is described here.)

Timeline for d2p7tc_: