Lineage for d2p7ja2 (2p7j A:9-180)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.110: Profilin-like [55769] (10 superfamilies)
core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
Superfamily d.110.6: Sensory domain-like [103190] (5 families) 
alpha(2)-beta(2)-alpha(2)-beta(3); possibly related to the PAS domain
Family d.110.6.2: YkuI C-terminal domain-like [143732] (3 proteins)
PfamB PB021678
Protein GGDEF family protein VP0354, N-terminal domain [419048] (1 species)
protein is N-terminal region; consists of two sensory domain-like domains; there is a canonical sensory (PAS) domain in the middle regionSpecies Vibrio parahaemolyticus [TaxId:670] [419535] (3 PDB entries)
Uniprot Q87SR8 35-206
Domain d2p7ja2: 2p7j A:9-180 [149288]
Other proteins in same PDB: d2p7ja1, d2p7jb1
complexed with acy, na, so4
Details for d2p7ja2
PDB Entry: 2p7j (more details), 2.25 Å
PDB Description: Crystal structure of the domain of putative sensory box/GGDEF family protein from Vibrio parahaemolyticus
PDB Compounds: (A:) Putative sensory box/GGDEF family proteinSCOPe Domain Sequences for d2p7ja2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2p7ja2 d.110.6.2 (A:9-180) GGDEF family protein VP0354, N-terminal domain {Vibrio parahaemolyticus [TaxId: 670]}
nnventakealhqlaytgreynniqdqietisdllghsqslydylrepskanltilenmw
ssvarnqklykqirfldtsgtekvrikydfktsiagpslilrdksareyfkyaqsldneq
isawgielerdkgelvyplspslrilmpisvndvrqgylvlnvdieylssll
SCOPe Domain Coordinates for d2p7ja2:
Click to download the PDB-style file with coordinates for d2p7ja2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2p7ja2:
- d2p7ja2 first appeared in SCOP 1.75
- d2p7ja2 appears in SCOPe 2.07
View in 3D
