Lineage for d2p6na_ (2p6n A:)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
3 layers: a/b/a, parallel or mixed beta-sheets of variable sizesSuperfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) 
division into families based on beta-sheet topologies
Family c.37.1.0: automated matches [191323] (1 protein)
not a true familyProtein automated matches [190123] (158 species)
not a true proteinSpecies Human (Homo sapiens) [TaxId:9606] [186862] (207 PDB entries) 
Domain d2p6na_: 2p6n A: [231135]
automated match to d2jgnb_
Details for d2p6na_
PDB Entry: 2p6n (more details), 2.6 Å
PDB Description: human dead-box rna helicase ddx41, helicase domain
PDB Compounds: (A:) ATP-dependent RNA helicase DDX41SCOPe Domain Sequences for d2p6na_:
Sequence, based on SEQRES records: (download)
>d2p6na_ c.37.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ldviqeveyvkeeakmvylleclqktpppvlifaekkadvdaiheylllkgveavaihgg
kdqeertkaieafregkkdvlvatdvaskgldfpaiqhvinydmpeeienyvhrigrtgc
sgntgiattfinkacdesvlmdlkallleakqkvppvlqvlhc
Sequence, based on observed residues (ATOM records): (download)
>d2p6na_ c.37.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ldviqeveyvkeeakmvylleclqktpppvlifaekkadvdaiheylllkgveavaihgg
kdqeertkaieafregkkdvlvatdvaskgldfpaiqhvinydmpeeienyvhrigrtgc
tgiattfinkacdesvlmdlkallleakqkvppvlqvlhc
SCOPe Domain Coordinates for d2p6na_:
Click to download the PDB-style file with coordinates for d2p6na_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2p6na_:
- d2p6na_ first appeared in SCOPe 2.03
- d2p6na_ appears in SCOPe 2.07
View in 3D
