Lineage for d2p24a2 (2p24 A:1-81)
- Root: SCOPe 2.04
Class d: Alpha and beta proteins (a+b) [53931] (380 folds) 
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
dimericSuperfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) 
Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins) 
Protein Class II MHC alpha chain, N-terminal domain [88806] (15 species) 
Species Mouse (Mus musculus), I-AK [TaxId:10090] [88813] (4 PDB entries) 
Domain d2p24a2: 2p24 A:1-81 [149170]
Other proteins in same PDB: d2p24a1
automated match to d1iaka2
Details for d2p24a2
PDB Entry: 2p24 (more details), 2.15 Å
PDB Description: I-Au/MBP125-135
PDB Compounds: (A:) H-2 class II histocompatibility antigen, A-U alpha chainSCOPe Domain Sequences for d2p24a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2p24a2 d.19.1.1 (A:1-81) Class II MHC alpha chain, N-terminal domain {Mouse (Mus musculus), I-AK [TaxId: 10090]}
ieadhvgsygivvyqspgdigqytfefdgdelfyvdldkketiwmlpefaqlrsfdpqgg
lqniatgkhnlgvltkrsnstp
SCOPe Domain Coordinates for d2p24a2:
Click to download the PDB-style file with coordinates for d2p24a2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2p24a2:
- d2p24a2 first appeared in SCOP 1.75
- d2p24a2 appears in SCOPe 2.03
- d2p24a2 appears in SCOPe 2.05
- d2p24a2 appears in the current release, SCOPe 2.08
View in 3D
