Lineage for d2oxqa_ (2oxq A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1898312Fold d.20: UBC-like [54494] (1 superfamily)
    alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2
  4. 1898313Superfamily d.20.1: UBC-like [54495] (5 families) (S)
  5. 1898314Family d.20.1.1: UBC-related [54496] (7 proteins)
  6. 1898507Protein automated matches [190124] (12 species)
    not a true protein
  7. 1898625Species Zebrafish (Danio rerio) [TaxId:7955] [188346] (1 PDB entry)
  8. 1898626Domain d2oxqa_: 2oxq A: [166912]
    Other proteins in same PDB: d2oxqc_, d2oxqd_
    automated match to d1ur6a_
    complexed with cl

Details for d2oxqa_

PDB Entry: 2oxq (more details), 2.9 Å

PDB Description: Structure of the UbcH5 :CHIP U-box complex
PDB Compounds: (A:) Ubiquitin-conjugating enzyme E2D 1

SCOPe Domain Sequences for d2oxqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2oxqa_ d.20.1.1 (A:) automated matches {Zebrafish (Danio rerio) [TaxId: 7955]}
gsmalkriqkelqdlqrdppaqcsagpvgddlfhwqatimgpsdspyqggvffltihfpt
dypfkppkvafttkiyhpninsngsicldilrsqwspaltvskvllsicsllcdpnpddp
lvpdiahiyksdkekynrlarewtqkyam

SCOPe Domain Coordinates for d2oxqa_:

Click to download the PDB-style file with coordinates for d2oxqa_.
(The format of our PDB-style files is described here.)

Timeline for d2oxqa_: