Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.20: UBC-like [54494] (1 superfamily) alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2 |
Superfamily d.20.1: UBC-like [54495] (5 families) |
Family d.20.1.1: UBC-related [54496] (7 proteins) |
Protein automated matches [190124] (12 species) not a true protein |
Species Zebrafish (Danio rerio) [TaxId:7955] [188346] (1 PDB entry) |
Domain d2oxqa_: 2oxq A: [166912] Other proteins in same PDB: d2oxqc_, d2oxqd_ automated match to d1ur6a_ complexed with cl |
PDB Entry: 2oxq (more details), 2.9 Å
SCOPe Domain Sequences for d2oxqa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2oxqa_ d.20.1.1 (A:) automated matches {Zebrafish (Danio rerio) [TaxId: 7955]} gsmalkriqkelqdlqrdppaqcsagpvgddlfhwqatimgpsdspyqggvffltihfpt dypfkppkvafttkiyhpninsngsicldilrsqwspaltvskvllsicsllcdpnpddp lvpdiahiyksdkekynrlarewtqkyam
Timeline for d2oxqa_: